They got it done earlier than expected and the best thing about it was it was 100% stress free for me! That would allow us to prevent animal access, control contamination from leaves, rain, ground water, temperature variation and evaporation.We purchased the 14' x 7' ATV Sport with three pumps and full option package. We have a great staff that really cares about our customers and community. The skimmer drains the water and retains any debris. (Only thing was I wish they had told me to go pick up the bigger rocks on the ground before installing the new liner. The first steps in deciding what pool filter is best for your pool is knowing what types of filters there are and how they work. I needed a new pump for my plug-n-play Marquis spa. After less than an hour Nick got my hot tub working again, (and got me out of the virtual dog house with the family).

Also a Great Job to (Forgot his name, sorry!!) All sand filters have an installed pressure gauge. Nick was able to troubleshoot the exact nature of the problem in less than 30 minutes. smart cleaner pool parts robotic leisure astral spare People working there are smart and quite friendly. Pete Alewine sells and services two types of pool filters: sand filters and cartridge filters. Made of ABS with UV treatment. Some of the cookies are necessary to navigate the site. inground Pursuant to the regulations in force on personal data protection, you are hereby informed that your personal data shall be processed by FLUIDRA S.A. (hereinafter FLUIDRA), located at Avda. Pete Alewine recently put in a pool for me. Advantages: Filters contaminants as small as 10 microns, no backwashing; less water waste, performs well at low speeds, such as with variable-speed pool pumps, cartridge inserts are inexpensive to replace, mid-cost filter Disadvantages: Requires slightly more manual work than sand pool filters, cartridge needs to be replaced every 2 to 3 years, deep cleaning required 1 to 2 times per year. If you disable this cookie, we will not be able to save your preferences. As they say, "There's an App! Advantages: Highest degree of water clarity, filters contaminants as small as 2 microns, DE powder can be added through the pool skimmer, no caustic chemicals are required for cleaning Disadvantages: Highest cost filter, requires more maintenance, grid needs to be replaced every 2 to 3 years, backwashing wastes water and may be restricted by location (check with your pool pro to find out), DE powder can be harmful if inhaled (Wear a mask!). The only pool company that would come out and look at issues with pool. Standard sand used in sand pool filters are capable of filtering contaminants that measure 20 microns and larger. We knew exactly what was happening and they always answered any of our questions. Just as your pool water is pumped through a sand filter, water flows into the cartridge filter tank and through the pleats where debris as small as 10 microns is captured, leaving only clean water to return to your pool. Available in 6 Sizes HydroMax DE Filters are designed and engineered from the inside out. Unique skimming technology continuously removes debris from the water surface, while the filter cartridge and the ultra-fine filter paper purifies the pool water. I highly recommend them. Get clear, clean water with our durable Side-Mount Sand Filters. Three different sizes to pick from, from small to large, a unit for every pool! Please check skimmer size opening before purchase. Very nice people, there helped me with everything I needed. We highly recommend Pete Alewine and his staff for all your pool and spa needs! I am very pleased with the hot tub and I highly recommend Pete Alewine Pools for both their expertise and their first-rate customer service. This is the pool cycle. Use of this site is subject to certain Terms Of Use. Chlorine Tabs. Two-in-one skimmer and filter solution : Joey was able to answer all of my questions, removing any doubts I might have on what would be the best option for me. First and foremost, what is diatomaceous earth? Super nice and are ALWAYS helpful to me!!

Target does not represent or warrant that this information is accurate or complete. I was in and out very quickly. He did this without ever making me feel pressured to purchase. We hear this question all the time. We needed to have city water delivered via tanker. when your cartridge gets dirty, just remove it from the filter unit, spray some filter cleaner on the cartridge, let it sit for 10 or 15 min and then wash it off with clean water and reinsert the cartridge into your filter unit. All Rights Reserved. Very helpful and nice. 2022 Zodiac Pool Systems LLC - All rights reserved. We do not send general messages unless they are segmented using the aforementioned procedure, as we consider that it is both in the best interests of FLUIDRA and the user to send or receive information that is relevant, and because not segmenting it would not alter the number of messages sent, but rather just their content. This pump skimmer set has everything you need for installation, including hoses and hose clamps. Thank you all! Would highly recommend them and would give more stars if possible. The water is then filtered by the integrated cartridge of 15 microns that delivers unbeatable filtration quality. The above item details were provided by the Target Plus Partner. Advantages: Low upfront cost, easy maintenance, sand lasts 5 to 7 years before needing to be changed, filtration efficiency can be boosted with additives or alternative media Disadvantages: 20-micron filtration is the least effective of the three types and backwashing is viewed by some as not environmentally friendly due to water waste. And all the crew at Pete Alewine's Pool and Spa! I started using them for all my supplies. Very friendly and understanding staff that has earned my loyalty. Due to mobility limitations, we had to install the swim spa partially into the elevated floor for handicapped accessibility. My pool was green when it was opened this year, and when I went to the store I was approached right away by a very helpful employee who went above and beyond talking me through what to do! When the internal pressure of the filter rises 10 psi from when it was last cleaned, the owner knows that it is time to clean out the residue inside the sand.

Above Ground Kit Includes 5 lbs Ph Plus 5 Lbs Alkalinity 1 Quart Liquid Magnet 1 Quart Black Algae Out 1 Quart Jump Start 1 Quart Krystal Klear 24 Lbs Jumbo 3" Slow Tab 24 Lbs Green Out Shock Jumbo 3" Slow Tab Chlorine Slow Dissolving Jumbo Tabs Manufactured to resist crumbling. Using genuine Jandy factory replacement parts helps to ensure the ongoing quality and reliability of our products. Capture up to 80% of all dirt and organic matter. Display ads that are relevant and engaging to you, as well as valuable to publishers ads such third parties. This is usually a job that takes less than ten minutes, does not require a service call, and does not require taking the filter apart. I called all the pool stores and theres no one who can do it. I am well out of their service area, but I can't express enough how grateful I am that they took the time to make sure I got my spa repaired. The media that it uses to do that job (sand, cartridges, etc. A sand filter holds 250 lbs or more of special filter sand.

- Sending you the newsletter, which at all times shall be customized and adapted to your interests. Are you in need of a sand change or a filter cartridge clean? From initial consultation to final transaction, I was extremely impressed with the professionalism. Still have a few things to finalize in the next day or so after the pool fills up, but I'm confident it should be smooth sailing with these 2 on site.

Images on this website are copyright to its respectful owners. SEO. Very pleased with our experience with them. Without them, you may have problems in the correct visualization of the page. We are now enjoying our pool year round! The Jandy Pro Series CV Filter design takes advantage of the filters total surface area, providing the clearest possible water and extending cleaning cycles. 2141 Babcock Blvd Pittsburgh, PA 15209 Ph: 1-888-GET-POOL. The color change is proposed with an inlet sheath EASYCOLOR- both the embellisher and the floater. If you have a specific question about this item, you may consult the item's label, contact the manufacturer directly or call Target Guest Services at 1-800-591-3869. Glad this place opened up close. I hired them to upgrade my pool pump, switch to a salt water system, new filter, etc. Designed for long-lasting and problem-free pool filtration that rids your pool of impurities, so you can swim, soak and splash around. As I was not the original purchaser they were unwilling to help. Sand filters are less expensive initially than their cartridge counterparts, are easy to maintain, and only require filter media changes every 5-7 years (depending on usage). filter sand ground above sandman wave system inch pump pools pool swimming filters gallon 1hp hp Pete and Toni are amazing people with a matching work ethic. Thanks!! I can now enjoy the rest of my summer . Highly professional and their customer service goes above and beyond. While you only need to replace the sand in your pool filter every 5 to 7 years, occasionally you will need to backwash the filter to clear out all the built-up debris. Every cartridge only needs to be replaced every 2 weeks, giving you the time to enjoy a refreshing summer all season long. skimmer gph canister summerbackyard This means that every time you visit this website you will need to enable or disable cookies again. All Rights Reserved.

If you need someone to reprogram your pool automation, ask them to send Nick. I only hope I can remember the name of who did which assist!My wife and I first met many years ago at a local neighborhood pool and wished to have one in our retirement. Just remove your old skimmer and replace with this unique water filtration system! Please enable Strictly Necessary Cookies first so that we can save your preferences! This website uses Google Analytics to collect anonymous information such as the number of visitors to the site, and the most popular pages. Easy to install to your skimmer wall cut out, all sized for standard hayward hole opennings. We can have a nice peaceful swim or turn on the whitewater rapids for my grandkids, come summer or winter.Thank you Pam, Donnie, Nick, Ryan, and Jeremy! In this case, you would remove the grids from the filter tank and hose off excess dirt before soaking them in a filter cleaning solution to remove body oils, suntan lotions, organic materials and minerals. Its job is to catch debris, so as to limit the particles floating out in the pool. Island Recreational. John took the time to research my part number and tell me where I could buy a new pump. skimmer weir into This pool was installed by Petes team in 2012 and we have always used the services from his locations. If you dont know for sure what kind and size skimmer opening you have, please call one of our stores for help! Customer Service was superb, efficient and quick. Local store prices may vary from those displayed. Country*COUNTRY*AUSTRALIAAUSTRIABELGIUMBRAZILBULGARIACANADACHILECHINACOLOMBIACROATIACYPRUSCZECH REPUBLICDENMARKEGYPTFRANCEGERMANYGREECEHONG KONGHUNGARYINDIAINDONESIAITALYKAZAHSTANMALAYSIAMEXICOMONTENEGROMOROCCONETHERLANDSNEW ZEALANDPOLANDPORTUGALROMANIARUSSIASERBIASINGAPORESOUTH AFRICASPAINSWEEDENSWITZERLANDTHAILANDTUNISIATURKEYUAEUNITED KINGDOMUSAVIETNAMOTHER COUNTRIES, Subject *Extra product informationComplete catalog. Reduces the amount of dirt going into your filter system and dramatically increases the length of the filter cycle. Aqua-line inline cartridge filters provide your pool with crystal clear water and can accommodate all size pool depending on unit. Awesome people and great and honest service. We had water delivered, and this time, I listened to Pam. This website claims no credit for any images posted on this site unless otherwise noted. Walked right up and fixed it! When the filter is doing its job, it plays a big role in creating the crystal-clear water that every swimmer desires. Including staying late 15 minutes on a Friday afternoon for me to get some chemicals!! The design of the CL Cartridge Filter takes advantage of the filters total surface area, providing the clearest water possible and extended cleaning cycles. This pool cleaning filter pump features a pump flow rate of 1,500 gallons per hour. Our line of inline cartridge filters are just the right match for all your pool filtering needs! To this regard, any users who do not wish to be segmented should refrain from signing up for the newsletter.Your data shall not be assigned, sold, leased or in any other way whatsoever made available to third parties. "But, with our water being unchlorinated and not exposed to the sun operating the pool, testing, balancing, and cleaning were unusually complicated. When I started looking for a Hot Tub, I returned to them. Thank you so very much for helping me. If you are thinking of having a pool installed you can't go wrong at Pete Alewine Pool & Spa. Every filter does the same thing. Contracted with Pete to redo the concrete, tile and plaster and we could not be happier with their work ! This website uses cookies so that we can provide you with the best user experience possible. The diatoms act just like a sponge water can pass through, but microscopic impurities like dirt, algae, and some forms of bacteria can't. Why You Should Only Work With A Qualified Professional. Need Help? The SFTM Top-Mount Pool Sand Filter directs water evenly across the entire surface of sand without sand migration or channeling. Are you ready to learn more about either type of filter?

Shawn did a great job tracing my husband and me pool maintenance. I tried several local companies in the Western North Carolina area including the dealer which originally sold the spa. Pete Alewine Pool & Spa is an Evans pool builder, retail store and pool service provider serving Augusta, Aiken, Columbia, Lexington and surrounding areas. Ensure your backyard pool water is clean with the Summer Waves SkimmerPlus Pool Pump Replacement with 4-Pack Spa Filter Cartridge.

Little did I know the manufacturer had no designated maintenance company in the CSRA. Less chemicals, less fussing, and less cost!!

Thank you for your service. After every cleaning, you'll need to add more DE powder. In a much more compact body, the Jandy Pro Series CS Filter line utilizes single element cartridges designed to provide the same great water filtration as the Zodiac Large Tank Filter series. See our price match guarantee. I reached out to Pete Alewine and they immediately sent out a repair representative. progrid hayward Both the initial filter purchase, and the cartridge elements themselves, are more expensive. Considering a single strand of human hair measures just 50 microns and bacteria can be as small as 2 microns, having a pool filter that can filter out the smallest contaminants from your pool water is essential to its clarity. Y'all are one in a million!

A cartridge filter uses cloth-type material as the filtering agent. I love our pool and the process was seamless! My experiences with Pete Alewine Pools and Spas have always been positive from the first time they came out to my home for Pool School. As a new homeowner who never previously had a pool, this was very informative. The Colossus Skimmer System Includes: Extra-Deep Sifter Basket 2X Deeper SYSTEM INCLUDES: Complete Skimmer Standard Basket Vacuum Adapter Complete Return Fitting Hardware Gaskets Easy AquaPerl Direct Replacement for Diatomaceous Earth D.E AquaPerl Perlite Filter Powder is a new, lightweight, direct replacement for diatomaceous earth media. But I believe her true forte is her knowledge of pool operation. She explained that we could use either chlorine or bromine. This is accomplished easily by backwashing the filter. App Store is a service mark of Apple Inc. Google Play is trademark of Google, Inc. All other trademarks referenced herein are the property of their respective owners. This filter pump attaches to the sidewalls of your framed pool and features easy maintenance and prevents tripping over hoses and pumps that would normally be on the ground. See how a store is chosen for you. In your professional swimming pool opinion, should we buy a sand filter or a cartridge filter? They showed up when they said they'd be there (a rare occurrence in Lexington), and did excellent work. The six-position versions fit Jandy Pro Series DEV and JS Sand Filters perfectly. They built our pool and spa! Nautical Reef Above Ground Swimming Pool Liner, Black Diamond 525 Quad Cartridge Filter Tank For In Ground Swimming Pools, The Colossus Complete Skimmer System for Above Ground Swimming Pools, Opening Pool Chemical Kit for Above and In Ground Swimming Pools, Opening Pool Chemical Kit for In Ground Swimming Pools, 8lb Jumbo 3" Slow Tab Swimming Pool Chlorine Trichloro, Green Out Premium Pool Shock 1 lb Bags Fast Acting Formula, Hayward EC40 DE Filter with Blue Torrent 1 Pump, HydroMax 85 Auto-Regen DE Filter System - Tank Only, Perlite Diatomaceous Earth Alternative for DE Pool Filter Systems. The recommended dosage is 1 Tablet per week for every 10,000 gallons of pool water. Francesc Maci, 60, planta 20, 08208 Sabadell (Barcelona) or an email to dataprivacy@fluidra.com, with the subject line Proteccin de Datos in both cases and a copy of a valid ID document.Should you wish to contact our DPO to submit any query or question, you may send an email to dataprivacy@fluidra.com or a letter to the address provided with the subject line "DPO". Filtering skimmer for concrete with 2 cartridges 16 m3 White, Filtering skimmer for prefabricated pools with 2 cartridges 16m3 White, Filtering skimmer for panel pools with 2 cartridges 16m3 White, Filtering skimmer for concrete with 2 cartridges 20 m3 White, Filtering skimmer for prefabricated pools with 2 cartridges 20m3 White, Filtering skimmer for panel pools with 2 cartridges 20m3 White. The measurement used is known as micrometer (micron for short), which is just one millionth of a meter. Lateral connections are for connecting suction nozzles. Sign up for regular updates and to get the Jandy Drop-In Replacement Guide for model comparisons, dimensions, and more. I recommended them.

Units will give you years of trouble free cleaning. ), is really the only difference. will test your water for free and advise you on the chemicals needed. A budget-friendly option that requires minimal maintenance, sand filters are ideal for in-ground or above-ground pools. document.getElementById("copyright_year").innerHTML = new Date().getFullYear(); The Colossus Skimmer System Includes: Extra-Deep Sifter Basket 2X Deeper, Above Ground Kit Includes 5 lbs Ph Plus 5 Lbs Alkalinity

Diatomaceous earth (DE) filters are capable of filtering particles as small as 2 to 3 microns, providing the cleanest, clearest water of all three types of pool filters. The innovative skimmer filtration system combines the functions of a skimmer and filter pump in one unit. There were big balance swings, excessive solids (remember that well water), and ever rising chlorine stabilizer!I had to drain the pool and restart. Appreciate that they have found cheaper alternative solutions when I came in asking for more expensive ones and have saved me $100s by giving me free advice to try before buying new products from them. This filtration system is specifically designed for Summer Wave framed pools. Pool filters are classified by the size of contaminants they can collect. On occasion, manufacturers may modify their items and update their labels. They did such a great job. A regular hose would take forever, possibly days. But we still didn't have enough well water to fill our pool. This allows them to catch and hold onto fine dirt and sand.

A pressure gauge on the sand filter alerts you when internal pressure increases and it's time to backwash the filter. We now have an 2" Camlock inlet for high speed filling and a separate outlet down stream for draining, all controlled by the Jandy Valve located under the house, with flood vents just in case.Nick, another spa technician came out and educated us on pool operation and initial setup. So budget-friendly and awesome work on my pool.

Very helpful staff with great quality pool products. We shocked with borate, sanitized with the bromine and oxidizer. The answer to that question comes down to what is important to you. They are staffed with hard working professionals who are also friendly and go out of their way to see that all things are running smoothly. He installed the LARGE filters, balanced and sterilized the water, and walked us through the controls from pumps to the LED lights and Wifi sound system. Maintenance is my #1 priority on the next spa I buy and Pete Alewine proved they have the very best service in the CSRA. Multi-port Valves are constructed of molded ABS material with durable plastic handles.

Wed would love the opportunity to earn your business! Over time, as the filter collects debris, you'll need to remove the pleated cartridge from within the tank to clean it. This field is for validation purposes and should be left unchanged. To enable or limit cookies, or to obtain more information, click onCustomize settings. We recommend that you do not rely solely on the information presented. Codes 73159 and 73162 are delivered with 2 sets of screws DIN 7982 A4 5.525 and 32. 3 models available and 2 sizes each (16m3 and 20m3 ): concrete, prefabricated and panel pools. Incorporate gate, regulator lid height, skimmer basket and 2 cartridge filters. If the item details above arent accurate or complete, we want to know about it. Power , Precision and Performance to give you clean water for your pool. I work here, so I may be biased. We had a miscommunication with pool service and when I brought it to their attention, they resolved the issue immediately.

2. Joey helped me get squared away and was there through the entire install. Be aware, some locations may have regulations that specify how to legally dispose of used DE. Very polite and friendly. As pool water is pumped through the filtration system, it's pushed through a filter tank filled with sand where contaminants and debris are caught on the spiky edges of each sand particle.